Mouse Anti-COLEC11 Antibody (CBMOAB-39688FYA)


Cat: CBMOAB-39688FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39688FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Zebrafish (Danio rerio) WB, ELISA MO39688FYA 100 µg
CBMOAB-71260FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO71260FYA 100 µg
MO-AB-01722W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01722W 100 µg
MO-AB-10531R Monoclonal Cattle (Bos taurus) WB, ELISA MO10531R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Zebrafish (Danio rerio)
CloneMO39688FYA
SpecificityThis antibody binds to Rhesus COLEC11.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCOLEC11 (Collectin Subfamily Member 11) is a Protein Coding gene. Diseases associated with COLEC11 include 3Mc Syndrome 2 and 3Mc Syndrome. Among its related pathways are Creation of C4 and C2 activators and Innate Immune System. Gene Ontology (GO) annotations related to this gene include mannose binding. An important paralog of this gene is COLEC10.
Product OverviewMouse Anti-Rhesus COLEC11 Antibody is a mouse antibody against COLEC11. It can be used for COLEC11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCOLEC11
UniProt IDF7H2F4
Protein RefseqThe length of the protein is 229 amino acids long.
The sequence is show below: SQPVMAASDISKRKHTSSFVEMGSQGDVGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETDSKIYLLVKEEKRYADAQLSCQGRGGTLGMPKDEAANGLMAAYLAQAGLARVFIGINDLEREGAFVYSDRSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKESM.
For Research Use Only | Not For Clinical Use.
Online Inquiry