Mouse Anti-COX4I1 Antibody (CBMOAB-39760FYA)
Cat: CBMOAB-39760FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-39760FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Fruit fly (Drosophila melanogaster), Insect, Mammal, Primat, Primate, Zebrafish (Danio rerio), Human, Mouse, Rat, Hamster, Goat, Monkey, Marmoset, Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO39760FYA | 100 µg | ||
CBMOAB-71390FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO71390FYA | 100 µg | ||
MO-AB-02595H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO02595C | 100 µg | ||
MO-AB-07691Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07691Y | 100 µg | ||
MO-AB-10633R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO10633R | 100 µg | ||
MO-AB-19680W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO19680W | 100 µg | ||
MO-AB-24829R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO24829R | 100 µg | ||
MO-AB-25006H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25006C | 100 µg | ||
MO-AB-53456W | Monoclonal | Marmoset | WB, ELISA | MO53456W | 100 µg | ||
MOF032922W124 | Monoclonal | Human, Mouse, Rat, Hamster, Goat, Monkey | WB, IHC-Fr, IHC-P, ICC/IF, IP, FC | 100 µg | |||
MO-NAB-00184W | Monoclonal | Human (Homo sapiens), Rat (Rattus norvegicus), Primate, Rhesus (Macaca mulatta) | WB, IF, IHC, IHC-P | NW0029 | 100 µg | ||
MO-DKB-00287W | Polyclonal | Human (Homo sapiens), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | ELISA, WB, IHC | 100 µg | |||
MO-DKB-00470W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Fruit fly (Drosophila melanogaster), Insect, Mammal, Primat | WB, Simple Western, ChIP, IF, IHC, IHC-P, IF, KD | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Fruit fly (Drosophila melanogaster), Insect, Mammal, Primat, Primate, Zebrafish (Danio rerio), Human, Mouse, Rat, Hamster, Goat, Monkey, Marmoset, Rabbit (Oryctolagus cuniculus) |
Clone | MO39760FYA |
Specificity | This antibody binds to Rhesus COX4I1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | COX4I1 (Cytochrome C Oxidase Subunit 4I1) is a Protein Coding gene. Diseases associated with COX4I1 include Calvarial Hyperostosis and Exocrine Pancreatic Insufficiency. Among its related pathways are Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. and Gene Expression. Gene Ontology (GO) annotations related to this gene include cytochrome-c oxidase activity. An important paralog of this gene is COX4I2. |
Product Overview | Mouse Anti-Rhesus COX4I1 Antibody is a mouse antibody against COX4I1. It can be used for COX4I1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Cytochrome c oxidase subunit 4 isoform 1, mitochondrial; COX4I1 |
UniProt ID | I0FPA8 |
Protein Refseq | The length of the protein is 169 amino acids long. The sequence is show below: MLATRVFSLVGKRAVSTSVCVRAHESVVKSEDFMLPAYVDRRDYPLPDVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRRSNEWKTVVGTAMFFIGITALIITWEKLYVYGPLPQTFDKEWVAMQTKRMLDMKVNPIQGLASKWDYEKNEWKK. |
For Research Use Only | Not For Clinical Use.
Online Inquiry