Mouse Anti-COX4I1 Antibody (CBMOAB-39760FYA)


Cat: CBMOAB-39760FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39760FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Fruit fly (Drosophila melanogaster), Insect, Mammal, Primat, Primate, Zebrafish (Danio rerio), Human, Mouse, Rat, Hamster, Goat, Monkey, Marmoset, Rabbit (Oryctolagus cuniculus) WB, ELISA MO39760FYA 100 µg
CBMOAB-71390FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO71390FYA 100 µg
MO-AB-02595H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02595C 100 µg
MO-AB-07691Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07691Y 100 µg
MO-AB-10633R Monoclonal Cattle (Bos taurus) WB, ELISA MO10633R 100 µg
MO-AB-19680W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19680W 100 µg
MO-AB-24829R Monoclonal Pig (Sus scrofa) WB, ELISA MO24829R 100 µg
MO-AB-25006H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25006C 100 µg
MO-AB-53456W Monoclonal Marmoset WB, ELISA MO53456W 100 µg
MOF032922W124 Monoclonal Human, Mouse, Rat, Hamster, Goat, Monkey WB, IHC-Fr, IHC-P, ICC/IF, IP, FC 100 µg
MO-NAB-00184W Monoclonal Human (Homo sapiens), Rat (Rattus norvegicus), Primate, Rhesus (Macaca mulatta) WB, IF, IHC, IHC-P NW0029 100 µg
MO-DKB-00287W Polyclonal Human (Homo sapiens), Rat (Rattus norvegicus), Zebrafish (Danio rerio) ELISA, WB, IHC 100 µg
MO-DKB-00470W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Fruit fly (Drosophila melanogaster), Insect, Mammal, Primat WB, Simple Western, ChIP, IF, IHC, IHC-P, IF, KD 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Fruit fly (Drosophila melanogaster), Insect, Mammal, Primat, Primate, Zebrafish (Danio rerio), Human, Mouse, Rat, Hamster, Goat, Monkey, Marmoset, Rabbit (Oryctolagus cuniculus)
CloneMO39760FYA
SpecificityThis antibody binds to Rhesus COX4I1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCOX4I1 (Cytochrome C Oxidase Subunit 4I1) is a Protein Coding gene. Diseases associated with COX4I1 include Calvarial Hyperostosis and Exocrine Pancreatic Insufficiency. Among its related pathways are Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. and Gene Expression. Gene Ontology (GO) annotations related to this gene include cytochrome-c oxidase activity. An important paralog of this gene is COX4I2.
Product OverviewMouse Anti-Rhesus COX4I1 Antibody is a mouse antibody against COX4I1. It can be used for COX4I1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome c oxidase subunit 4 isoform 1, mitochondrial; COX4I1
UniProt IDI0FPA8
Protein RefseqThe length of the protein is 169 amino acids long.
The sequence is show below: MLATRVFSLVGKRAVSTSVCVRAHESVVKSEDFMLPAYVDRRDYPLPDVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRRSNEWKTVVGTAMFFIGITALIITWEKLYVYGPLPQTFDKEWVAMQTKRMLDMKVNPIQGLASKWDYEKNEWKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry