Mouse Anti-COX5B Antibody (MO-AB-29872W)


Cat: MO-AB-29872W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-29872W Monoclonal Dog (Canis lupus familiaris), Cattle (Bos taurus), Fruit fly (Drosophila melanogaster), Marmoset, O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Yeast WB, ELISA MO29872W 100 µg
CBMOAB-13810FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO13810FYA 100 µg
CBMOAB-00828CR Monoclonal Yeast WB, ELISA MO00828CR 100 µg
MO-AB-53460W Monoclonal Marmoset WB, ELISA MO53460W 100 µg
MO-AB-10635R Monoclonal Cattle (Bos taurus) WB, ELISA MO10635R 100 µg
MO-AB-25009H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25009C 100 µg
MO-AB-11049Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO11049Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityDog (Canis lupus familiaris), Cattle (Bos taurus), Fruit fly (Drosophila melanogaster), Marmoset, O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Yeast
CloneMO29872W
SpecificityThis antibody binds to Dog COX5B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCOX5B (Cytochrome C Oxidase Subunit 5B) is a Protein Coding gene. Among its related pathways are Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. and Gene Expression. Gene Ontology (GO) annotations related to this gene include cytochrome-c oxidase activity.
Product OverviewMouse Anti-Dog COX5B Antibody is a mouse antibody against COX5B. It can be used for COX5B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome c oxidase polypeptide Vb; cox5b; COX5B
UniProt IDB7ZDP5
Protein RefseqThe length of the protein is 128 amino acids long.
The sequence is show below: MKRGSAALEVRELKLQTPTASCVLSTQRANFAKGGVPTDDEQATGLEREVMMAARKGLDPYNILAPKAAAGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPHQLAH.
For Research Use Only | Not For Clinical Use.
Online Inquiry