Mouse Anti-COX7A2 Antibody (CBMOAB-39766FYA)


Cat: CBMOAB-39766FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39766FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO39766FYA 100 µg
MO-AB-02606H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02606C 100 µg
MO-AB-10642R Monoclonal Cattle (Bos taurus) WB, ELISA MO10642R 100 µg
MO-AB-18711W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18711W 100 µg
MO-AB-24831R Monoclonal Pig (Sus scrofa) WB, ELISA MO24831R 100 µg
MO-AB-25018H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25018C 100 µg
MO-AB-29878W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29878W 100 µg
MO-AB-53464W Monoclonal Marmoset WB, ELISA MO53464W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO39766FYA
SpecificityThis antibody binds to Rhesus COX7A2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus COX7A2 Antibody is a mouse antibody against COX7A2. It can be used for COX7A2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome c oxidase subunit 7A2, mitochondrial; COX7A2
UniProt IDH9Z5D2
Protein RefseqThe length of the protein is 115 amino acids long.
The sequence is show below: MLTQVSEVVPVPAWPFSLLVLSCGGCWSVTAKMLRNLLALRQIGQRTISTTSRRHLQNKVPEKQKLFQEDDGIPLYLKGGIADVLLYRATMVLGVGGTAYALYQLAVAAFPKKQE.
For Research Use Only | Not For Clinical Use.
Online Inquiry