AibGenesis™ Mouse Anti-CPQ Antibody (CBMOAB-39821FYA)


Cat: CBMOAB-39821FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39821FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Marmoset WB, ELISA MO39821FYA 100 µg
MO-AB-10683R Monoclonal Cattle (Bos taurus) WB, ELISA MO10683R 100 µg
MO-AB-19082W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19082W 100 µg
MO-AB-34622W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34622W 100 µg
MO-AB-53489W Monoclonal Marmoset WB, ELISA MO53489W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Marmoset
CloneMO39821FYA
SpecificityThis antibody binds to Rhesus CPQ.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CPQ Antibody is a mouse antibody against CPQ. It can be used for CPQ detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCPQ
UniProt IDF7H5T8
Protein RefseqThe length of the protein is 472 amino acids long.
The sequence is show below: MKFLIFAFFGGAHLLSLCSGKAIYKNGISKRTFQEIKEEIASYGDVAKAIINLAVYGKAQNRSYERLALLVDTVGPRLSGSKNLEKAIQIMYQNLQQDGLENVHLEPVRIPHWERGEESAVMLEPRIHKIAILGLGSSIGTPPEGITAEVLVVTSFDELQRRASEARGKIVVYNQPYINYSRTVQYRTQGAVEAAKVGAVASLIRSVASLSIYSPHTGIQEYQDGVPKIPTACITVEDAEMMSRMASRGIKIVIQLKMGAKTYLDTDSFNTVAEITGSKYPEQVVLVSGHLDSWDVGQGAMDDGGGAFISWEALSLIKDLGLRPKRTLRLVLWTAEEQGGVGAFQYYQLHKVNISNYSLVMESDTGTFLPTGLQFTGSEKARAIMEEVMSLLQPLNITQVLSHGEGTDINFWIQAGVPGASLLDDLYKYFFFHHSHGDTMTVMDPKQMNVAAAVWAVVSYVVADMEEMLPKS.
For Research Use Only | Not For Clinical Use.
Online Inquiry