Mouse Anti-CR1 Antibody (CBMOAB-39840FYA)


Cat: CBMOAB-39840FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39840FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human, Rhesus, Cynomolgus, Chimpanzee, Baboon, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) WB, ELISA MO39840FYA 100 µg
MO-AB-01745W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01745W 100 µg
MO-AB-02633H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02633C 100 µg
MO-AB-07700Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07700Y 100 µg
MO-AB-25050H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25050C 100 µg
MO-AB-26987W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26987W 100 µg
MOFY-0522-FY40 Monoclonal Human, Rhesus, Cynomolgus, Chimpanzee, Baboon FC, IHC, WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human, Rhesus, Cynomolgus, Chimpanzee, Baboon, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus)
CloneMO39840FYA
SpecificityThis antibody binds to Rhesus CR1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCR1 (Complement C3b/C4b Receptor 1 (Knops Blood Group)) is a Protein Coding gene. Diseases associated with CR1 include Malaria and Plasmodium Falciparum Malaria. Among its related pathways are Creation of C4 and C2 activators and Primary Focal Segmental Glomerulosclerosis FSGS. Gene Ontology (GO) annotations related to this gene include complement component C3b binding and complement component C4b receptor activity. An important paralog of this gene is CSMD1.
Product OverviewMouse Anti-Rhesus CR1 Antibody is a mouse antibody against CR1. It can be used for CR1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCR1
UniProt IDF7GSU3
Protein RefseqThe length of the protein is 544 amino acids long.
The sequence is show below: GHCKAPDHFPFAKLKTQTIASDFPIGTSLKYECRPEYYGRPFSITCLDNLVWSSPKDVCKRKSCKTPPDPVNGMVHVITDIQVGSRINYSCTTGHRLIGHSSAECVISGNTAHWSKKPPICQRIPCGLPPAIANGDFISTNREYFHYGSVVTYRCNLGSGRKKLFELVGEPSIYCTSKDGQVGIWSGPAPQCIIPNKCTPPNVENGILVSVNRSLFSLNEVVEFRCQPGFVMKGPRRVQCQALNKWEPELPSCSRVCQSPPDVLHGERTQRDKDIFQPGQEVFYICEPGYDLRGAASLRCTPQGDWSPAAPRCEVKSCDDSLGQLPNGRVLFPRSLQLGAKVDFVCDEGKYQPGTVAHACNPSTFGRSWRPAWPTWRKIFCPSPPVIPNGRHTGKPLEVFPFGKAVTYTCDPHPDRGMTFDLIGESTIRCTSDPQGNGVWSSPAPRCGILGHCNAPDHFLFAKLKTQTNASDFPIGTSLKYECRPEYYGRPFSITCLDNLVWSSPKDVCKRKSCKTPPDPVNGMVHVITDIQVGSRINYSCTTG.
For Research Use Only | Not For Clinical Use.
Online Inquiry