Mouse Anti-CRP Antibody (CBMOAB-39917FYA)
Cat: CBMOAB-39917FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-39917FYA | Monoclonal | Rhesus (Macaca mulatta), Bovine, Rat, Cattle (Bos taurus), Chicken (Gallus gallus), Dog, Dog (Canis lupus familiaris), E. coli (Escherichia coli ), E. coli (Escherichia coli), Guinea pig, Guinea pig (Cavia porcellus), O. mykiss (Oncorhynchus mykiss), Ovis aries, Sheep, Pig, Human, Mouse, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO39917FYA | 100 µg | ||
CBMOAB-0427YC | Monoclonal | E. coli (Escherichia coli ) | WB, ELISA | MO0427YC | 100 µg | ||
CBMOAB-71755FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO71755FYA | 100 µg | ||
MO-AB-29903W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29903W | 100 µg | ||
MO-AB-41460W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41460W | 100 µg | ||
MO-AB-10750R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO10750R | 100 µg | ||
MO-AB-25101H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25101C | 100 µg | ||
MO-AB-01430Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO01430Y | 100 µg | ||
MO-AB-07703Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07703Y | 100 µg | ||
MO-AB-11079Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO11079Y | 100 µg | ||
MO-DKB-00289W | Polyclonal | E. coli (Escherichia coli) | ELISA | 100 µg | |||
MOFY-0622-FY24 | Monoclonal | Guinea pig | WB, IHC, ICC, IP | 100 µg | |||
MOFY-0622-FY97 | Polyclonal | Ovis aries, Sheep | WB, IHC, ICC, IP | 100 µg | |||
MOFY-0622-FY133 | Polyclonal | Guinea pig | WB, IHC, ICC, IF | 100 µg | |||
MOFY-0622-FY141 | Polyclonal | Guinea pig | WB, IHC, ICC, IP | 100 µg | |||
MOFY-0622-FY163 | Polyclonal | Guinea pig | WB, IHC, ICC | 100 µg | |||
MOFY-0722-FY144 | Polyclonal | Dog | WB, IHC, ICC, IP | 100 µg | |||
MOFY-0722-FY239 | Polyclonal | Pig, Human, Mouse, Rat | WB, IHC, ICC, IP | 100 µg | |||
MOFY-0722-FY306 | Polyclonal | Bovine, Rat | WB, IHC, ICC, IP | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Bovine, Rat, Cattle (Bos taurus), Chicken (Gallus gallus), Dog, Dog (Canis lupus familiaris), E. coli (Escherichia coli ), E. coli (Escherichia coli), Guinea pig, Guinea pig (Cavia porcellus), O. mykiss (Oncorhynchus mykiss), Ovis aries, Sheep, Pig, Human, Mouse, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
Clone | MO39917FYA |
Specificity | This antibody binds to Rhesus CRP. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | CRP (C-Reactive Protein) is a Protein Coding gene. Diseases associated with CRP include Acute Pancreatitis and Appendicitis. Among its related pathways are Creation of C4 and C2 activators and Overview of nanoparticle effects. Gene Ontology (GO) annotations related to this gene include calcium ion binding and cholesterol binding. An important paralog of this gene is APCS. |
Product Overview | Mouse Anti-Rhesus CRP Antibody is a mouse antibody against CRP. It can be used for CRP detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | CRP |
UniProt ID | F7DHP5 |
Protein Refseq | The length of the protein is 102 amino acids long. The sequence is show below: MEKLLCFLVLTSLSHAFGQTDMSMKAFVFPKESDNSYVTLKARLTKPLKAFTVCLHFYTELSSTHEISTVYRGGTFSPSVLYWRALKYEVQGEVFIKPQLWS. |
See other products for " Crp "
CBMOAB-14173FYA | Mouse Anti-Crp Antibody (CBMOAB-14173FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry