Mouse Anti-CTF1 Antibody (CBMOAB-40041FYA)


Cat: CBMOAB-40041FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40041FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO40041FYA 100 µg
MO-AB-25181H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25181C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO40041FYA
SpecificityThis antibody binds to Rhesus CTF1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCTF1 (Cardiotrophin 1) is a Protein Coding gene. Diseases associated with CTF1 include Neonatal Stroke and Hypertensive Heart Disease. Among its related pathways are NFAT and Cardiac Hypertrophy and Cytokine Signaling in Immune system. Gene Ontology (GO) annotations related to this gene include cytokine activity and leukemia inhibitory factor receptor binding.
Product OverviewMouse Anti-Rhesus CTF1 Antibody is a mouse antibody against CTF1. It can be used for CTF1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCTF1
UniProt IDF7DNW9
Protein RefseqThe length of the protein is 201 amino acids long.
The sequence is show below: MSRREGNLEDPQADSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDVVRRRQAELNPRAQRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPTATASAASAAGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLAGGPA.
For Research Use Only | Not For Clinical Use.
Online Inquiry