Mouse Anti-CTGF Antibody (CBMOAB-40042FYA)


Cat: CBMOAB-40042FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40042FYA Monoclonal Rhesus (Macaca mulatta), Goat, Marmoset, Pig (Sus scrofa), Rabbit, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO40042FYA 100 µg
CBMOAB-72128FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO72128FYA 100 µg
MO-AB-07729Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07729Y 100 µg
MO-AB-24949R Monoclonal Pig (Sus scrofa) WB, ELISA MO24949R 100 µg
MO-AB-25183H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25183C 100 µg
MO-AB-53687W Monoclonal Marmoset WB, ELISA MO53687W 100 µg
MOFY-0622-FY190 Polyclonal Rabbit WB, IHC, ICC, IP 100 µg
MOFY-0722-FY400 Polyclonal Goat WB, IHC, ICC, IP 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Goat, Marmoset, Pig (Sus scrofa), Rabbit, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO40042FYA
SpecificityThis antibody binds to Rhesus CTGF.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCTGF (Connective Tissue Growth Factor) is a Protein Coding gene. Diseases associated with CTGF include Systemic Scleroderma and Renal Fibrosis. Among its related pathways are Apoptotic Pathways in Synovial Fibroblasts and PAK Pathway. Gene Ontology (GO) annotations related to this gene include growth factor activity and integrin binding. An important paralog of this gene is NOV.
Product OverviewMouse Anti-Rhesus CTGF Antibody is a mouse antibody against CTGF. It can be used for CTGF detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCTGF
UniProt IDF7BV52
Protein RefseqThe length of the protein is 253 amino acids long.
The sequence is show below: AKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRVTNDNASCRLEKQSRLCMVRPCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSVKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA.
For Research Use Only | Not For Clinical Use.
Online Inquiry