Mouse Anti-CTLA4 Antibody (CBMOAB-40046FYA)
Cat: CBMOAB-40046FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-40046FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Marmoset, Mouse (Mus musculus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO40046FYA | 100 µg | ||
| CBMOAB-72147FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO72147FYA | 100 µg | ||
| MO-AB-01460Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO01460Y | 100 µg | ||
| MO-AB-07733Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07733Y | 100 µg | ||
| MO-AB-07833W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO07833W | 100 µg | ||
| MO-AB-10904R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO10904R | 100 µg | ||
| MO-AB-14759Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14759Y | 100 µg | ||
| MO-AB-24954R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO24954R | 100 µg | ||
| MO-AB-25188H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25188C | 100 µg | ||
| MO-AB-29933W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29933W | 100 µg | ||
| MO-AB-53693W | Monoclonal | Marmoset | WB, ELISA | MO53693W | 100 µg | ||
| MO-AB-70613W | Monoclonal | Mouse (Mus musculus) | ELISA, WB | 4E12D1 | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Marmoset, Mouse (Mus musculus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) |
| Clone | MO40046FYA |
| Specificity | This antibody binds to Rhesus CTLA4. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28. |
| Product Overview | Mouse Anti-Rhesus CTLA4 Antibody is a mouse antibody against CTLA4. It can be used for CTLA4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | CTLA4 |
| UniProt ID | F7ATG6 |
| Protein Refseq | The length of the protein is 174 amino acids long. The sequence is show below: MACLGFQRHKARLNLATRTRPYTLLFSLLFIPVFSKAMHVAQPAVVLANSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYMGIGNGTQIYVIAKEKKPSHNRGLCENAPNRARM. |
For Research Use Only | Not For Clinical Use.
Online Inquiry