Mouse Anti-CTSW Antibody (MO-AB-07936W)


Cat: MO-AB-07936W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-07936W Monoclonal Cat (Felis catus), Cattle (Bos taurus) WB, ELISA MO07936W 100 µg
MO-AB-10938R Monoclonal Cattle (Bos taurus) WB, ELISA MO10938R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus), Cattle (Bos taurus)
CloneMO07936W
SpecificityThis antibody binds to Cat CTSW.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cat CTSW Antibody is a mouse antibody against CTSW. It can be used for CTSW detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCathepsin W; CTSW
UniProt IDA0A0A0MPY8
Protein RefseqThe length of the protein is 374 amino acids long.
The sequence is show below: MAITVYLSCLLVLSMAGLAQGIKSSLRSQDPGPQPLELKQAFTLFQIQYNRSYSNPEEYARRLDIFAHNLAQAQQLEEEDLGTAEFGVTPFSDLTEEEFGRLYGHRRMDGEAPKVGREVGSEEWGESVPPTCDWRKLDGVISSVKKQESCSCCWAMAAAGNIEALWAIKYRQSVELSVQELLDCGRCGDGCRGGFVWDAFITVLNNSGLASEKDYPFRGQVKPHRCLAKKRTKVAWIQDFIMLPDNEQKIAWYLATQGPITVTINMKLLKLYKKGVIEATPTSCDPFLVDHSVLLVGFGKSESVADRRAGAAGAQPQSRRSIPFWILKNSWGTKWGEKGYFRLYRGNNTCGITKYPLTARVDQPAKKRPVSCPP.
For Research Use Only | Not For Clinical Use.
Online Inquiry