Mouse Anti-CXCL12 Antibody (CBMOAB-40150FYA)


Cat: CBMOAB-40150FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40150FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO40150FYA 100 µg
MO-AB-01477Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01477Y 100 µg
MO-AB-08165W Monoclonal Cat (Felis catus) WB, ELISA MO08165W 100 µg
MO-AB-10967R Monoclonal Cattle (Bos taurus) WB, ELISA MO10967R 100 µg
MO-AB-20721W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20721W 100 µg
MO-AB-24987R Monoclonal Pig (Sus scrofa) WB, ELISA MO24987R 100 µg
MO-AB-25212H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25212C 100 µg
MO-AB-29962W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29962W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO40150FYA
SpecificityThis antibody binds to Rhesus CXCL12.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCXCL12 (C-X-C Motif Chemokine Ligand 12) is a Protein Coding gene. Diseases associated with CXCL12 include Human Immunodeficiency Virus Type 1 and Aids Dementia Complex. Among its related pathways are Apoptotic Pathways in Synovial Fibroblasts and PAK Pathway. Gene Ontology (GO) annotations related to this gene include receptor binding and chemokine activity.
Product OverviewMouse Anti-Rhesus CXCL12 Antibody is a mouse antibody against CXCL12. It can be used for CXCL12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCXCL12
UniProt IDF7E098
Protein RefseqThe length of the protein is 119 amino acids long.
The sequence is show below: MNAKVVVVLALVLTTLCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKGRREEKVGKKEKIGKKKRQKKRKAAQKRKN.
For Research Use Only | Not For Clinical Use.
Online Inquiry