Mouse Anti-CXCL16 Antibody (CBMOAB-40153FYA)


Cat: CBMOAB-40153FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40153FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO40153FYA 100 µg
MO-AB-10970R Monoclonal Cattle (Bos taurus) WB, ELISA MO10970R 100 µg
MO-AB-23875W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23875W 100 µg
MO-AB-25216H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25216C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO40153FYA
SpecificityThis antibody binds to Rhesus CXCL16.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCXCL16 (C-X-C Motif Chemokine Ligand 16) is a Protein Coding gene. Diseases associated with CXCL16 include Xanthogranulomatous Cholecystitis. Among its related pathways are PEDF Induced Signaling and Akt Signaling. Gene Ontology (GO) annotations related to this gene include chemokine activity and low-density lipoprotein receptor activity.
Product OverviewMouse Anti-Rhesus CXCL16 Antibody is a mouse antibody against CXCL16. It can be used for CXCL16 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC-X-C motif chemokine 16; CXCL16
UniProt IDH9ZBT6
Protein RefseqThe length of the protein is 270 amino acids long.
The sequence is show below: MSGSQSAAAPSPQTPRSPDMGQALVPGARALLLLLLLACLPPPGNGNEGTVTGSCHCSKRISSDSPPSAQFMNRLRKHLRAYHHCLHYIRFQLPSWSVCGGSKDPWVRELMSCLDLKECGHAYLGSVAHQEHLPPTSTPISQASEGASSDIRTPTQMLLSILQSTQCPTPPAGSLSLHKELTRPSETTIPTAGHSLGVGLEAGENQKQLKNNAGPTAGTSATVPVLSLLAIVFILTALLSYVLCKRRGQSPQSSPDLQLHYIPVASDSNT.
For Research Use Only | Not For Clinical Use.
Online Inquiry