AibGenesis™ Mouse Anti-cyba Antibody (MO-AB-02775H)


Cat: MO-AB-02775H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-02775H Monoclonal Frog (Xenopus laevis), Cattle (Bos taurus), Dog (Canis lupus familiaris) WB, ELISA MO02775C 100 µg
MO-AB-29981W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29981W 100 µg
MO-AB-11006R Monoclonal Cattle (Bos taurus) WB, ELISA MO11006R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis), Cattle (Bos taurus), Dog (Canis lupus familiaris)
CloneMO02775C
SpecificityThis antibody binds to Frog cyba.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against cyba. It can be used for cyba detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMGC80750 protein; cyba; MGC80750
UniProt IDQ6AZJ1
Protein RefseqThe length of the protein is 187 amino acids long.
The sequence is show below: MGQIEWAMWANEQALASGLILLAGGIIAVAGQFKGWEFGAYGIAAGAFITLLEYPRSKRKKGSTMERCGQKYLAAVVKVFGPLTRNYYVRAILHAGLAVPGGFILATILGTVCLGIASIIYFLAAIRGEEWRYMEKQAEPKPRPGETIKRPPENPPPRPPAEVRRKQADEVSAEGGHVNPIPVTDNV.
For Research Use Only | Not For Clinical Use.
Online Inquiry