Mouse Anti-CYBB Antibody (CBMOAB-40204FYA)


Cat: CBMOAB-40204FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40204FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), E. coli (Escherichia coli ), Zebrafish (Danio rerio) WB, ELISA MO40204FYA 100 µg
CBMOAB-0468YC Monoclonal E. coli (Escherichia coli ) WB, ELISA MO0468YC 100 µg
CBMOAB-72540FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO72540FYA 100 µg
MO-AB-11007R Monoclonal Cattle (Bos taurus) WB, ELISA MO11007R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), E. coli (Escherichia coli ), Zebrafish (Danio rerio)
CloneMO40204FYA
SpecificityThis antibody binds to Rhesus CYBB.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCYBB (Cytochrome B-245 Beta Chain) is a Protein Coding gene. Diseases associated with CYBB include Immunodeficiency 34 and Granulomatous Disease, Chronic, X-Linked. Among its related pathways are Innate Immune System and RET signaling. Gene Ontology (GO) annotations related to this gene include protein heterodimerization activity and heme binding. An important paralog of this gene is NOX1.
Product OverviewMouse Anti-Rhesus CYBB Antibody is a mouse antibody against CYBB. It can be used for CYBB detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome b-245 heavy chain; CYBB
UniProt IDH9FA72
Protein RefseqThe length of the protein is 311 amino acids long.
The sequence is show below: PQFAGNPPMTWKWIVGPMFLYLCERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLRLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAKTLSKQSISNSESGPRGVHFIFNKENF.
For Research Use Only | Not For Clinical Use.
Online Inquiry