Mouse Anti-CYP3A5 Antibody (CBMOAB-40280FYA)


Cat: CBMOAB-40280FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40280FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset WB, ELISA MO40280FYA 100 µg
MO-AB-02811H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02811C 100 µg
MO-AB-11062R Monoclonal Cattle (Bos taurus) WB, ELISA MO11062R 100 µg
MO-AB-14992W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14992W 100 µg
MO-AB-53851W Monoclonal Marmoset WB, ELISA MO53851W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset
CloneMO40280FYA
SpecificityThis antibody binds to Rhesus CYP3A5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCYP3A5 (Cytochrome P450 Family 3 Subfamily A Member 5) is a Protein Coding gene. Diseases associated with CYP3A5 include Hypertension, Essential and Tacrolimus Dose Selection. Among its related pathways are Tamoxifen Pathway, Pharmacokinetics and Vinka Alkaloid Pathway, Pharmacokinetics. Gene Ontology (GO) annotations related to this gene include oxidoreductase activity and heme binding. An important paralog of this gene is CYP3A4.
Product OverviewMouse Anti-Rhesus CYP3A5 Antibody is a mouse antibody against CYP3A5. It can be used for CYP3A5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCYP3A5
UniProt IDB2ZBF6
Protein RefseqThe length of the protein is 251 amino acids long.
The sequence is show below: VLVKECYSVFTNRRHRVDFLQLMIDSQNSKETESHKALSDQELVAQSIIFIFAGYETTSSVLSFIIYELATHPDVQQKLQKEIDAVLPNKAPATYDAMVQMEYLDMVVNETLRLFPIAIRLERACKKDVEINGVFIPKGAMVVIPTYALHHDPKYWTEPEEFRPERFSKKNKDSIDPYIYTPFGTGPRNCIGMRFALMNMKLAIIKVLQNFSFKPCKETQIPLKLGNQGLLQSEKPIVLKVESRDGTLSGE.
For Research Use Only | Not For Clinical Use.
Online Inquiry