Mouse Anti-CYP4V2 Antibody (CBMOAB-40307FYA)


Cat: CBMOAB-40307FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40307FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Pig (Sus scrofa) WB, ELISA MO40307FYA 100 µg
MO-AB-02820H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02820C 100 µg
MO-AB-11070R Monoclonal Cattle (Bos taurus) WB, ELISA MO11070R 100 µg
MO-AB-25071R Monoclonal Pig (Sus scrofa) WB, ELISA MO25071R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Pig (Sus scrofa)
CloneMO40307FYA
SpecificityThis antibody binds to Rhesus CYP4V2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCYP4V2 (Cytochrome P450 Family 4 Subfamily V Member 2) is a Protein Coding gene. Diseases associated with CYP4V2 include Bietti Crystalline Corneoretinal Dystrophy and Telangiectatic Osteogenic Sarcoma. Among its related pathways are Metabolism and Cytochrome P450 - arranged by substrate type. Gene Ontology (GO) annotations related to this gene include iron ion binding and oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen. An important paralog of this gene is CYP4F2.
Product OverviewMouse Anti-Rhesus CYP4V2 Antibody is a mouse antibody against CYP4V2. It can be used for CYP4V2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCYP4V2
UniProt IDF6PJB6
Protein RefseqThe length of the protein is 503 amino acids long.
The sequence is show below: MAGIWLGLVWQKLLLWGAASAVSLAGASLVLSLLQRVASYQMRPIPTEREFFQQIIEYTEEYRHMPLLKLWVGPVPMVALYNAENVEVILTSSKQIDKSSMYKFLEPWLGLGLLTSTGNKWRSRRKMLTPTFHFTILEDFLDIMNEQANILVKKLEKHVNQEAFNCFVYITLCALDIICETAMGKNIGAQSNDDSEYVRAVYRMSEMIFRRIKMPWLWLDLWYLMFKEGWEHKKSLKILHAFTNNVIAERANEMNVDEDCRGDGRDSAPSKNKRRAFLDLLLSVTDDEGNRLSHEDIREEVDTFMFEGHDTTAAAMNWSLYLLGSNPEVQKKVDHELDDVFGMSDRPATVEDLKKLRYLECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFRPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTILSCILRHFWIESNQKREELGLEGQLILRPTNGIWIKLKRRNADEP.
For Research Use Only | Not For Clinical Use.
Online Inquiry