Mouse Anti-D. melanogaster 4Ehp (clone MO00331FYA) Antibody (CBMOAB-00331FYA)


Cat: CBMOAB-00331FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO00331FYA
SpecificityThis antibody binds to fruit fly 4Ehp.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Introduction4EHP, EIF4E-Homologous Protein (4EHP) binds the 7-methyl-guanosine cap structure of mRNA and functions as a negative regulator of translation.
Product OverviewMouse Anti-D. melanogaster 4Ehp (clone MO00331FYA) Antibody (CBMOAB-00331FYA) is a mouse antibody against 4Ehp. It can be used for 4Ehp detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names4EHP, isoform A; SD07020p; 4EHP; Syx1A
UniProt IDQ8T3K5
Protein RefseqThe length of the protein is 223 amino acids long.
The sequence is show below: MSMEKVANKQYETKNWPDIVDSDDSDVDNQIDVDNLPPLEVGPGENRLQHTYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPYRELLLFKQGIIPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAMLGEQFLVGDEICGVVLQTKYPEDSLSVWHRTATDMTSTTRIRDTLRRILNIPLTTALEYKIHCDSLKYVSINKGPLKS.
For Research Use Only | Not For Clinical Use.

Online Inquiry