Mouse Anti-D. melanogaster 4Ehp-Rb Antibody (CBMOAB-00333FYA)


Cat: CBMOAB-00333FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO00333FYA
SpecificityThis antibody binds to fruit fly 4Ehp-Rb.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster 4Ehp-Rb (clone MO00333FYA) Antibody (CBMOAB-00333FYA) is a mouse antibody against 4Ehp-Rb. It can be used for 4Ehp-Rb detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMIP18429p; 4EHP-RB
UniProt IDD5SHR7
Protein RefseqThe length of the protein is 90 amino acids long.
The sequence is show below: MHQTNWSRELVDFCFDHTKLPTANVRPALHARLFLIQFVNSPFDLLNEQRINGKMKTQNCNYNSNSANQHVFTTKTRATTTAKKKKKHPS.
For Research Use Only | Not For Clinical Use.

Online Inquiry