Cat: CBMOAB-00333FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Fruit fly (Drosophila melanogaster) |
Clone | MO00333FYA |
Specificity | This antibody binds to fruit fly 4Ehp-Rb. |
Format | Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | Mouse Anti-D. melanogaster 4Ehp-Rb (clone MO00333FYA) Antibody (CBMOAB-00333FYA) is a mouse antibody against 4Ehp-Rb. It can be used for 4Ehp-Rb detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | MIP18429p; 4EHP-RB |
UniProt ID | D5SHR7 |
Protein Refseq | The length of the protein is 90 amino acids long. The sequence is show below: MHQTNWSRELVDFCFDHTKLPTANVRPALHARLFLIQFVNSPFDLLNEQRINGKMKTQNCNYNSNSANQHVFTTKTRATTTAKKKKKHPS. |
See other products for " 4Ehp-Rb "
For Research Use Only | Not For Clinical Use.