Cat: CBMOAB-00340FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Fruit fly (Drosophila melanogaster) |
Clone | MO00340FYA |
Specificity | This antibody binds to fruit fly 5-Ht1A. |
Format | Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | Mouse Anti-D. melanogaster 5-Ht1A (clone MO00340FYA) Antibody (CBMOAB-00340FYA) is a mouse antibody against 5-Ht1A. It can be used for 5-Ht1A detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | 5-HT1A; Fragment |
UniProt ID | Q5MUB9 |
Protein Refseq | The length of the protein is 44 amino acids long. The sequence is show below: NVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYX. |
See other products for " 5-Ht1A "
CBMOAB-00344FYA | Mouse Anti-D. melanogaster 5-Ht1A Antibody (CBMOAB-00344FYA) |
CBMOAB-00337FYA | Mouse Anti-D. melanogaster 5-Ht1A Antibody (CBMOAB-00337FYA) |
CBMOAB-00347FYA | Mouse Anti-D. melanogaster 5-Ht1A Antibody (CBMOAB-00347FYA) |
MO-AB-41153W | Mouse Anti-Guinea pig 5-HT1A Antibody (MO-AB-41153W) |
CBMOAB-00342FYA | Mouse Anti-D. melanogaster 5-Ht1A Antibody (CBMOAB-00342FYA) |
CBMOAB-00343FYA | Mouse Anti-D. melanogaster 5-Ht1A Antibody (CBMOAB-00343FYA) |
CBMOAB-00341FYA | Mouse Anti-D. melanogaster 5-Ht1A Antibody (CBMOAB-00341FYA) |
CBMOAB-00346FYA | Mouse Anti-D. melanogaster 5-Ht1A Antibody (CBMOAB-00346FYA) |
CBMOAB-00338FYA | Mouse Anti-D. melanogaster 5-Ht1A Antibody (CBMOAB-00338FYA) |
CBMOAB-00345FYA | Mouse Anti-D. melanogaster 5-Ht1A Antibody (CBMOAB-00345FYA) |
For Research Use Only | Not For Clinical Use.