Mouse Anti-D. melanogaster 5-Ht2 Antibody (CBMOAB-00359FYA)


Cat: CBMOAB-00359FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO00359FYA
SpecificityThis antibody binds to fruit fly 5-Ht2.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster 5-Ht2 (clone MO00359FYA) Antibody (CBMOAB-00359FYA) is a mouse antibody against 5-Ht2. It can be used for 5-Ht2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names5-HT2; Fragment
UniProt IDQ5MRC8
Protein RefseqThe length of the protein is 288 amino acids long.
The sequence is show below: YWPLGFTWCNIYVTCDVLACSSSILDMCFISLGRYMGIRNPLGSRHRSTKRLTGIKIAIVWVMAMMVSSSITVLGLVNEKNIMPEPNICVINNRAFFVFGSLVAFYIPMLMMVTTYALTIPLLRKKARFAAEHPESELFRRLGGRFTLRPQHSQQQLQMFSSFSGSNNKFLSMGDGNRNFNTEGEMEEGGAPSRRSGVEPAERPLMQQRTASSRSMGTVSFRNVVNGTSGAAGSGRRTTGTAHSSFRFSGAGILRHSSSSPASSCHSTSTSRSSSFWRKHGGYPNLMD.
For Research Use Only | Not For Clinical Use.

Online Inquiry