Cat: CBMOAB-00384FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Fruit fly (Drosophila melanogaster) |
| Clone | MO00384FYA |
| Specificity | This antibody binds to fruit fly 5-Ht2. |
| Format | Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-D. melanogaster 5-Ht2 (clone MO00384FYA) Antibody (CBMOAB-00384FYA) is a mouse antibody against 5-Ht2. It can be used for 5-Ht2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | 5-HT2; Fragment |
| UniProt ID | Q5MRQ8 |
| Protein Refseq | The length of the protein is 73 amino acids long. The sequence is show below: YWPLGFTWCNIYVTCDVLACSSSILHMCFISLGRYMGIRNXLGSRHRSTKRLTGIKIXIVWVMAMMVSSSITV. |
Reference
See other products for " 5-Ht2 "
| CBMOAB-00392FYA | Mouse Anti-D. melanogaster 5-Ht2 Antibody (CBMOAB-00392FYA) |
| CBMOAB-00387FYA | Mouse Anti-D. melanogaster 5-Ht2 Antibody (CBMOAB-00387FYA) |
| CBMOAB-00401FYA | Mouse Anti-D. melanogaster 5-Ht2 Antibody (CBMOAB-00401FYA) |
| CBMOAB-00364FYA | Mouse Anti-D. melanogaster 5-Ht2 Antibody (CBMOAB-00364FYA) |
| CBMOAB-00365FYA | Mouse Anti-D. melanogaster 5-Ht2 Antibody (CBMOAB-00365FYA) |
| CBMOAB-00389FYA | Mouse Anti-D. melanogaster 5-Ht2 Antibody (CBMOAB-00389FYA) |
| CBMOAB-00398FYA | Mouse Anti-D. melanogaster 5-Ht2 Antibody (CBMOAB-00398FYA) |
| CBMOAB-00360FYA | Mouse Anti-D. melanogaster 5-Ht2 Antibody (CBMOAB-00360FYA) |
| CBMOAB-00408FYA | Mouse Anti-D. melanogaster 5-Ht2 Antibody (CBMOAB-00408FYA) |
| CBMOAB-00399FYA | Mouse Anti-D. melanogaster 5-Ht2 Antibody (CBMOAB-00399FYA) |
For Research Use Only | Not For Clinical Use.