Connect with Us at the Upcoming Events

With in-person events back again, Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at 2022 BIO International Convention in June (booth #1754) and at the 13th Annual World ADC San Diego in September (booth number to be updated) for expert consultation on your drug discovery. Shoot an email to arrange an in-person meeting!

Mouse Anti-D. melanogaster 5-Ht2 Antibody (CBMOAB-00392FYA)


Cat: CBMOAB-00392FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO00392FYA
SpecificityThis antibody binds to fruit fly 5-Ht2.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster 5-Ht2 (clone MO00392FYA) Antibody (CBMOAB-00392FYA) is a mouse antibody against 5-Ht2. It can be used for 5-Ht2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names5-HT2; Fragment
UniProt IDQ5MV97
Protein RefseqThe length of the protein is 128 amino acids long.
The sequence is show below: HLRLSLVPPSSXPNRRAXVRVXISQPQLGYPTNVGGNGGGTVGATEVGXGGNGSSAGRTSNSSPGGTSLMKIATIQGPILNQSQAAGGNHMVQKVKPTALKPEEPQRNKVRPFKFAFNRVATPTLNLR.

See other products for " 5-Ht2 "

CBMOAB-00393FYAMouse Anti-D. melanogaster 5-Ht2 Antibody (CBMOAB-00393FYA)
CBMOAB-00416FYAMouse Anti-D. melanogaster 5-Ht2 Antibody (CBMOAB-00416FYA)
CBMOAB-00389FYAMouse Anti-D. melanogaster 5-Ht2 Antibody (CBMOAB-00389FYA)
CBMOAB-00410FYAMouse Anti-D. melanogaster 5-Ht2 Antibody (CBMOAB-00410FYA)
CBMOAB-00364FYAMouse Anti-D. melanogaster 5-Ht2 Antibody (CBMOAB-00364FYA)
CBMOAB-00383FYAMouse Anti-D. melanogaster 5-Ht2 Antibody (CBMOAB-00383FYA)
CBMOAB-00372FYAMouse Anti-D. melanogaster 5-Ht2 Antibody (CBMOAB-00372FYA)
CBMOAB-00357FYAMouse Anti-D. melanogaster 5-Ht2 Antibody (CBMOAB-00357FYA)
CBMOAB-00385FYAMouse Anti-D. melanogaster 5-Ht2 Antibody (CBMOAB-00385FYA)
CBMOAB-00353FYAMouse Anti-D. melanogaster 5-Ht2 Antibody (CBMOAB-00353FYA)
For Research Use Only | Not For Clinical Use.

Online Inquiry