Mouse Anti-D. melanogaster A2Bp1 Antibody (CBMOAB-00447FYA)


Cat: CBMOAB-00447FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO00447FYA
SpecificityThis antibody binds to fruit fly A2Bp1.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster A2Bp1 (clone MO00447FYA) Antibody (CBMOAB-00447FYA) is a mouse antibody against A2Bp1. It can be used for A2Bp1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAtaxin-2 binding protein 1, isoform M; A2bp1
UniProt IDM9PF74
Protein RefseqThe length of the protein is 547 amino acids long.
The sequence is show below: MYYPSTVLIANEAAESQQSSAMQNAGGGGNTGGGGGGGGGGTPSSPLSNSPSSATASQAGGCGLTLNGSATEGSMSGDTSPVASGEPLLQTPPAHQQQQQQQQPLLCSSPTSMQSSGTSVTGSSIASGTLAATSSSGVGLLPTTGLDSIANGGAPTGCAVVPASTSQVIAHLNAAAAAASGIVSPSANVATSLSSALVPAQSVAAVAAASLDAKSQPKRLHVSNIPFRFRDPDLRAMFGQFGTILDVEIIFNERGSKGFGFVTFANSNDAERARERLHGTVVEGRKIEVNNATARVQTKKVTAVPNVVLTKDGAIPAPALVCVQWPEGYRLPVAAWPFLGAPVGAGAPTLTHLQLPVSMQMAQAPSAVAGGTAATSPATAAAAAAHAAAAAAATPIMLAPRPPHTAVQAATPTAATPRRSVYYDPFLAAAASADPNLRFQAAKPVTEVPAAQPAAILNATAPLLKTPLSQAQQQAYATAATTYTAVAARAAYGAAAAAAAQPALAGYATVAGYAREYADPYLGHGIGPVPGYGATMYRGGFNRFTPY.

Reference

See other products for " A2Bp1 "

CBMOAB-00449FYAMouse Anti-D. melanogaster A2Bp1 Antibody (CBMOAB-00449FYA)
CBMOAB-00443FYAMouse Anti-D. melanogaster A2Bp1 Antibody (CBMOAB-00443FYA)
CBMOAB-00451FYAMouse Anti-D. melanogaster A2Bp1 Antibody (CBMOAB-00451FYA)
CBMOAB-00452FYAMouse Anti-D. melanogaster A2Bp1 Antibody (CBMOAB-00452FYA)
MO-AB-06698RMouse Anti-Cattle A2BP1 Antibody (MO-AB-06698R)
CBMOAB-00448FYAMouse Anti-D. melanogaster A2Bp1 Antibody (CBMOAB-00448FYA)
CBMOAB-00444FYAMouse Anti-D. melanogaster A2Bp1 Antibody (CBMOAB-00444FYA)
CBMOAB-00445FYAMouse Anti-D. melanogaster A2Bp1 Antibody (CBMOAB-00445FYA)
CBMOAB-00450FYAMouse Anti-D. melanogaster A2Bp1 Antibody (CBMOAB-00450FYA)
CBMOAB-34734FYAMouse Anti-Rhesus A2BP1 Antibody (CBMOAB-34734FYA)
For Research Use Only | Not For Clinical Use.

Online Inquiry