Mouse Anti-D. melanogaster Abd-B Antibody (CBMOAB-00497FYA)


Cat: CBMOAB-00497FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO00497FYA
SpecificityThis antibody binds to fruit fly Abd-B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Product OverviewMouse Anti-D. melanogaster Abd-B (clone MO00497FYA) Antibody (CBMOAB-00497FYA) is a mouse antibody against Abd-B. It can be used for Abd-B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDrosophila pH189 mRNA of distal BX-C region (bithorax complex) coding for homeoprotein; confering r element function; Abd-B
UniProt IDQ9VEQ7
Protein RefseqThe length of the protein is 110 amino acids long.
The sequence is show below: MGLGGQGGAGVLGSWGSGGNHESERERAYEPKSKRFPLAERRKVVISYSPHSRTHVPHTAHTQPASTHTSRPEYLCACVCIPLKGCCSGFGAWRFFTVRRPSIYHFTMAF.
For Research Use Only | Not For Clinical Use.

Online Inquiry