Mouse Anti-D. melanogaster Acp24A4 Antibody (CBMOAB-00569FYA)
Cat: CBMOAB-00569FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Specifications
- Application Information
- Target
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Fruit fly (Drosophila melanogaster) |
Clone | MO00569FYA |
Specificity | This antibody binds to fruit fly Acp24A4. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Extracellular region or secreted |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This protein is transferred from male to female''s hemolymph during mating, affecting egglaying and behavior after mating. |
Product Overview | Mouse Anti-D. melanogaster Acp24A4 Antibody is a mouse antibody against Acp24A4. It can be used for Acp24A4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | ACP24A4; Acp24A4 |
UniProt ID | Q45WF1 |
Protein Refseq | The length of the protein is 78 amino acids long. The sequence is show below: MKLLILLFVFIALASNSLALKNEICGLPAAANGNCLALFSRWSCDAQYNVCFNFIYGGCQGNDNSFESQEECINKCVE. |
For Research Use Only | Not For Clinical Use.
Online Inquiry