Mouse Anti-D. melanogaster Atg13 Antibody (CBMOAB-01987FYA)
Cat: CBMOAB-01987FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Fruit fly (Drosophila melanogaster) |
Clone | MO01987FYA |
Specificity | This antibody binds to fruit fly Atg13. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is an autophagy factor and a target of the TOR kinase signaling pathway. The encoded protein is essential for autophagosome formation and mitophagy. |
Product Overview | Mouse Anti-D. melanogaster Atg13 Antibody is a mouse antibody against Atg13. It can be used for Atg13 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | HL01508p; Atg13 |
UniProt ID | Q95S16 |
Protein Refseq | The length of the protein is 50 amino acids long. The sequence is show below: MPLVMSLVSFYLWKGGQYGERQGQTKISRTTLERLLGKVKVLSSAFLSSF. |
See other products for " ATG13 "
CBMOAB-00370CR | Mouse Anti-Yeast ATG13 Antibody (CBMOAB-00370CR) |
MO-AB-16879W | Mouse Anti-Chimpanzee ATG13 Antibody (MO-AB-16879W) |
MO-AB-07276Y | Mouse Anti-Rabbit ATG13 Antibody (MO-AB-07276Y) |
MO-AB-41274W | Mouse Anti-Guinea pig ATG13 Antibody (MO-AB-41274W) |
CBMOAB-36485FYA | Mouse Anti-Rhesus ATG13 Antibody (CBMOAB-36485FYA) |
MO-AB-00205Y | Mouse Anti-Chicken ATG13 Antibody (MO-AB-00205Y) |
MO-AB-34428W | Mouse Anti-Ferret ATG13 Antibody (MO-AB-34428W) |
MO-AB-51459W | Mouse Anti-Marmoset ATG13 Antibody (MO-AB-51459W) |
MO-AB-23907R | Mouse Anti-Pig ATG13 Antibody (MO-AB-23907R) |
MO-AB-00117L | Mouse Anti-Elephant ATG13 Antibody (MO-AB-00117L) |
For Research Use Only | Not For Clinical Use.
Online Inquiry