Mouse Anti-D. melanogaster Csp1 Antibody (CBMOAB-14212FYA)


Cat: CBMOAB-14212FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO14212FYA
SpecificityThis antibody binds to fruit fly Csp1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCysteine protease which, in vitro, cleaves itself and caspase ced-3 into their mature active forms (PubMed:9857046). Also cleaves, in vitro, inactive caspase csp-2 isoform b (PubMed:9857046). Required maternally to induce apoptosis in a subset of cells fated to die during embryogenesis, mostly independently of the ced-9, ced-4 and ced-3 canonical apoptosis pathway (PubMed:23505386). Involved in the degeneration of dopaminergic CEP neurons in response to high Mn levels (PubMed:23721876).
Product OverviewMouse Anti-D. melanogaster Csp1 Antibody is a mouse antibody against Csp1. It can be used for Csp1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCG30172; Putative chemosensory protein CSP1; CSP1
UniProt IDQ8MLP9
Protein RefseqThe length of the protein is 112 amino acids long.
The sequence is show below: MLLLNKNRVISLVVNFIFLIILISSSVQADERNINKLLNNQVVVSRQIMCILGKSECDQLGLQLKAALPEVITRKCRNCSPQQAQKAQKLTTFLQTRYPDVWAMLLRKYDSA.
For Research Use Only | Not For Clinical Use.
Online Inquiry