Mouse Anti-D. melanogaster Csp1 Antibody (CBMOAB-14212FYA)


Cat: CBMOAB-14212FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO14212FYA
SpecificityThis antibody binds to fruit fly Csp1.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Csp1 (clone MO14212FYA) Antibody (CBMOAB-14212FYA) is a mouse antibody against Csp1. It can be used for Csp1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCG30172; Putative chemosensory protein CSP1; CSP1
UniProt IDQ8MLP9
Protein RefseqThe length of the protein is 112 amino acids long.
The sequence is show below: MLLLNKNRVISLVVNFIFLIILISSSVQADERNINKLLNNQVVVSRQIMCILGKSECDQLGLQLKAALPEVITRKCRNCSPQQAQKAQKLTTFLQTRYPDVWAMLLRKYDSA.
For Research Use Only | Not For Clinical Use.

Online Inquiry