Mouse Anti-D. melanogaster Fer Antibody (CBMOAB-16745FYA)
Cat: CBMOAB-16745FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Fruit fly (Drosophila melanogaster) |
| Clone | MO16745FYA |
| Specificity | This antibody binds to fruit fly Fer. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is a member of the FPS/FES family of non-transmembrane receptor tyrosine kinases. It regulates cell-cell adhesion and mediates signaling from the cell surface to the cytoskeleton via growth factor receptors. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome X. |
| Product Overview | Mouse Anti-D. melanogaster Fer Antibody is a mouse antibody against Fer. It can be used for Fer detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Cytoplasmic tyrosine kinase; Fragment; FER; fer Fps85D |
| UniProt ID | Q8WRX4 |
| Protein Refseq | The length of the protein is 68 amino acids long. The sequence is show below: QRSNSTSSPGLGIMNELMRRGGVLTLLRGRGRHFKRKSTPQPATPMTRSRQGRFNKLQPRSQSLGSLS. |
See other products for " FER "
| MO-DKB-0206RA | Rabbit Anti-FER Antibody (MO-DKB-0206RA) |
| MO-AB-06476Y | Mouse Anti-O. anatinus FER Antibody (MO-AB-06476Y) |
| MO-DKB-04034W | Rabbit Anti-FER (N-terminal) Antibody (Cat MO-DKB-04034W) |
| CBMOAB-42796FYA | Mouse Anti-Rhesus FER Antibody (CBMOAB-42796FYA) |
| MO-AB-12488R | Mouse Anti-Cattle FER Antibody (MO-AB-12488R) |
| MO-AB-30759W | Mouse Anti-Dog FER Antibody (MO-AB-30759W) |
| CBMOAB-61163FYC | Mouse Anti-Zebrafish fer Antibody (CBMOAB-61163FYC) |
| MO-AB-41640W | Mouse Anti-Guinea pig FER Antibody (MO-AB-41640W) |
| MO-AB-34489H | Mouse Anti-Tomato Fer Antibody (MO-AB-34489H) |
| MO-AB-15237Y | Mouse Anti-Sheep FER Antibody (MO-AB-15237Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry