Mouse Anti-D. melanogaster Hrg Antibody (CBMOAB-20765FYA)


Cat: CBMOAB-20765FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO20765FYA
SpecificityThis antibody binds to fruit fly Hrg.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis histidine-rich glycoprotein contains two cystatin-like domains and is located in plasma and platelets. The physiological function has not been determined but it is known that the protein binds heme, dyes and divalent metal ions. The encoded protein also has a peptide that displays antimicrobial activity against C. albicans, E. coli, S. aureus, P. aeruginosa, and E. faecalis. It can inhibit rosette formation and interacts with heparin, thrombospondin and plasminogen. Two of the protein's effects, the inhibition of fibrinolysis and the reduction of inhibition of coagulation, indicate a potential prothrombotic effect. Mutations in this gene lead to thrombophilia due to abnormal histidine-rich glycoprotein levels.
Product OverviewMouse Anti-D. melanogaster Hrg (clone MO20765FYA) Antibody (CBMOAB-20765FYA) is a mouse antibody against Hrg. It can be used for Hrg detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPoly A polymerase; Fragment; hrg; PAP
UniProt IDQ9NDU2
Protein RefseqThe length of the protein is 255 amino acids long.
The sequence is show below: MWNSEPTHRQHHQHNGNSTSGGPPAKQLGMTSAISLAEPRPEDLQRTDELRGSLEPYNVFESQDELNHRMEILAKLNTLVKQWVKEISVSKNMPESAAEKLGGKIYTFGSYRLGVHHKGADIDALCVAPRNIERTDYFQSFFEVLKKQPEVTECRSVEEAFVPVIKMNFDGIEIDLLFARLSLKEIPDDFDLRDDNLLRNLDHRSVRSLNGCRVTDEILALVPNIENFRLALRTIKLWAKKHGIYSNSLGYFGGV.
For Research Use Only | Not For Clinical Use.

Online Inquiry