Mouse Anti-D. melanogaster Mlc1 Antibody (CBMOAB-24352FYA)


Cat: CBMOAB-24352FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO24352FYA
SpecificityThis antibody binds to fruit fly Mlc1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe function of this gene product is unknown; however, homology to other proteins suggests that it may be an integral membrane transporter. Mutations in this gene have been associated with megalencephalic leukoencephalopathy with subcortical cysts, an autosomal recessive neurological disorder. Alternatively spliced transcript variants encoding different isoforms have been identified.
Product OverviewMouse Anti-D. melanogaster Mlc1 Antibody is a mouse antibody against Mlc1. It can be used for Mlc1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMyosin light chain alkali; Mlc1; MLC-ALK
UniProt IDP06742
Protein RefseqThe length of the protein is 155 amino acids long.
The sequence is show below: MADVPKREVENVEFVFEVMGSPGEGIDAVDLGDALRALNLNPTLALIEKLGGTKKRNEKKIKLDEFLPIYSQVKKEKEQGCYEDFIECLKLYDKEENGTMLLAELQHALLALGESLDDEQVETLFADCMDPEDDEGFIPYSQFVQRLMSDPVVFD.
For Research Use Only | Not For Clinical Use.
Online Inquiry