Mouse Anti-D. melanogaster Os9 Antibody (CBMOAB-26995FYA)


Cat: CBMOAB-26995FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO26995FYA
SpecificityThis antibody binds to fruit fly Os9.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that is highly expressed in osteosarcomas. This protein binds to the hypoxia-inducible factor 1 (HIF-1), a key regulator of the hypoxic response and angiogenesis, and promotes the degradation of one of its subunits. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Product OverviewMouse Anti-D. melanogaster Os9 (clone MO26995FYA) Antibody (CBMOAB-26995FYA) is a mouse antibody against Os9. It can be used for Os9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory-specific 9; OS9
UniProt IDQ9I7M1
Protein RefseqThe length of the protein is 199 amino acids long.
The sequence is show below: MASRLTWTFLVAVAALQLSLAAPLINKWQLQFEVSNELFQMVTDAMEQLRHVFQLVIDEAELILPPNSKGHILRELKDFVAALDTLDFDDSFELNRLEDALEELESIISIAGSKEFESEADEVVVQLFIQHGVEDLEQILERNLETTLKIVEQKVEKYMSTWSDSRLARNAAMVKQFNDFKNEKDVYEKLDKLTNSDFI.
For Research Use Only | Not For Clinical Use.

Online Inquiry