Mouse Anti-D. melanogaster Pex14 Antibody (CBMOAB-27475FYA)


Cat: CBMOAB-27475FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO27475FYA
SpecificityThis antibody binds to fruit fly Pex14.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPeroxisome; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an essential component of the peroxisomal import machinery. The protein is integrated into peroxisome membranes with its C-terminus exposed to the cytosol, and interacts with the cytosolic receptor for proteins containing a PTS1 peroxisomal targeting signal. The protein also functions as a transcriptional corepressor and interacts with a histone deacetylase. A mutation in this gene results in one form of Zellweger syndrome.
Product OverviewMouse Anti-D. melanogaster Pex14 Antibody is a mouse antibody against Pex14. It can be used for Pex14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCG4289-PA; RE22286p; Pex14
UniProt IDQ9VPB8
Protein RefseqThe length of the protein is 280 amino acids long.
The sequence is show below: MSSNNTDTGDTTVMATATSVQNDVEAGVDEQLPRESLITTAVSFLQNTKVRHTTLIQKQQFLRSKGLTAHEIQLACERAGVFTQDPNKPNPNPNTVISIGSQLHALQPQPTVLGRIREIIHSAALFSGVVYAVYIFWKQYIAPYLFGKSKKKAVDEVLDDIDKKVETRTNDLNKEILAVRDLITTQQREHAQQLNREFSNFRSDLDAIKGLLLNRKQFAGPVAPIAVPSIPAWQLAGSPHHHHRHSGSDDNEKGDDAGSGSGSSETEVVTKNSDSSLEIM.
For Research Use Only | Not For Clinical Use.
Online Inquiry