Mouse Anti-D. melanogaster Rbp4 Antibody (CBMOAB-28843FYA)


Cat: CBMOAB-28843FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO28843FYA
SpecificityThis antibody binds to fruit fly Rbp4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein posttranslationally and results in defective delivery and supply to the epidermal cells.
Product OverviewMouse Anti-D. melanogaster Rbp4 Antibody is a mouse antibody against Rbp4. It can be used for Rbp4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRNA-binding protein 4; Rbp4
UniProt IDQ9VFT3
Protein RefseqThe length of the protein is 428 amino acids long.
The sequence is show below: MDAGNCASSACLGDCKGDGKTAIKEEGYEHLRKIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRARPHTIDNKIVETKHALPRQDFKRGGGVGSVVGSFGCEAGFMNSKRIFLGGLKEYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALAPRKHWILQTLVEVKRSTQKADRRFRFPIFSSVRAGYIPPQPATADSYNYNNPNYNPYLAQSVLPPSAFTNGWAHYVIPMAPKPTPGQNMAASLPSQQLAEHSLNGHGPDMWSSYPKTGIYSAQEWTSSKVAEWGPKAGHKHAQTSTNDRAKIDLKELQAATFNNKLDFGARGDADRMSGAGLGLGLTGGAAVGVGAIKKWPTQDYKVFKPAKSPTNGVIPKIGKEATTPPYGI.
For Research Use Only | Not For Clinical Use.
Online Inquiry