Mouse Anti-D. melanogaster Usp14 Antibody (CBMOAB-34018FYA)


Cat: CBMOAB-34018FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO34018FYA
SpecificityThis antibody binds to fruit fly Usp14.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the ubiquitin-specific processing (UBP) family of proteases that is a deubiquitinating enzyme (DUB) with His and Cys domains. This protein is located in the cytoplasm and cleaves the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins. Mice with a mutation that results in reduced expression of the ortholog of this protein are retarded for growth, develop severe tremors by 2 to 3 weeks of age followed by hindlimb paralysis and death by 6 to 10 weeks of age. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Product OverviewMouse Anti-D. melanogaster Usp14 Antibody is a mouse antibody against Usp14. It can be used for Usp14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUbiquitin carboxyl-terminal hydrolase; EC 3.4.19.12; Usp14
UniProt IDQ9VKZ8
Protein RefseqThe length of the protein is 475 amino acids long.
The sequence is show below: MPAFKVKVKWGRELYTDIVVNTDEEPILFKAQLFALTGVQPDRQKVMCKGGILKDDQWNLQIKDGAVVLLLGSKESVPEVPATPVKFIEDMNEAEAATAMRLPAGLTNLGNTCYMNATVQCLNAVPELRTALSTFSNDGTDTMSTAFSISSAMKSIFAQMEKGTTVTPIVLLQALHRASPQFAQTGENGTYRQQDANECWAEILKMLQQKLRPKNQEPSNTVQKRHSSFIDQFFGGTFEVKMSSEEDPDEPSTVTSENFLQLSCFISMDVKYMQSGLKSKMKEQLVKKSETLGRDAKYIRTYLVSRLPAYLTVQFVRFQYKGKEGINAKVLKDIKFPIDFDAFELCTPELQNKLCPMRSKFKDLEDKKMEVDVVKRNEPNEEKKDVKYEQFWFDDDLGSNNSGYYTLQAVLTHKGRSSSSGHYVAWVRSSGDVWFKFDDDEVSAVATDEILRLSGGGDWHCAYVLLYAPRRLEKL.
See other products for " USP14 "
MO-DKB-00755WRabbit Anti-USP14 Antibody (MO-DKB-00755W)
MO-AB-23862HMouse Anti-Mallard USP14 Antibody (MO-AB-23862H)
MO-DKB-01179WRabbit Anti-USP14 Antibody (MO-DKB-01179W)
MO-AB-33961WMouse Anti-Dog USP14 Antibody (MO-AB-33961W)
MO-AB-42807WMouse Anti-Guinea pig USP14 Antibody (MO-AB-42807W)
CBMOAB-00313FYARabbit Anti-Zebrafish Usp14 Antibody (CBMOAB-00313FYA)
MO-AB-67486WMouse Anti-Marmoset USP14 Antibody (MO-AB-67486W)
MO-AB-10416YMouse Anti-Rabbit USP14 Antibody (MO-AB-10416Y)
CBMOAB-13058HCBMouse Anti-C. elegans USP14 Antibody (CBMOAB-13058HCB)
MO-AB-04706YMouse Anti-Chicken USP14 Antibody (MO-AB-04706Y)
For Research Use Only | Not For Clinical Use.
Online Inquiry