Mouse Anti-DGAT1 Antibody (CBMOAB-27452FYC)
Cat: CBMOAB-27452FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-27452FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Donkey (Equus asinus), Goat (Capra hircus), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Rhesus (Macaca mulatta), Sheep (Ovis aries) | WB, ELISA | MO27452FC | 100 µg | ||
CBMOAB-40687FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO40687FYA | 100 µg | ||
MO-AB-08437W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08437W | 100 µg | ||
MO-AB-17544W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO17544W | 100 µg | ||
MO-AB-30137W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO30137W | 100 µg | ||
MO-AB-34204W | Monoclonal | Donkey (Equus asinus) | WB, ELISA | MO34204W | 100 µg | ||
MO-AB-37125W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO37125W | 100 µg | ||
MO-AB-41556W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41556W | 100 µg | ||
MO-AB-44409W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44409W | 100 µg | ||
MO-AB-54126W | Monoclonal | Marmoset | WB, ELISA | MO54126W | 100 µg | ||
MO-AB-11389R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO11389R | 100 µg | ||
MO-AB-25352R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO25352R | 100 µg | ||
MO-AB-14938Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14938Y | 100 µg | ||
MO-DKB-02288W | Polyclonal | A. thaliana (Arabidopsis thaliana) | WB | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Donkey (Equus asinus), Goat (Capra hircus), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Rhesus (Macaca mulatta), Sheep (Ovis aries) |
Clone | MO27452FC |
Specificity | This antibody binds to Arabidopsis DGAT1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Chloroplast; Endoplasmic reticulum; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes an multipass transmembrane protein that functions as a key metabolic enzyme. The encoded protein catalyzes the conversion of diacylglycerol and fatty acyl CoA to triacylglycerol. This enzyme can also transfer acyl CoA to retinol. Activity of this protein may be associated with obesity and other metabolic diseases. |
Product Overview | Mouse Anti-Arabidopsis DGAT1 Antibody is a mouse antibody against DGAT1. It can be used for DGAT1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Diacylglycerol O-Acyltransferase 1; Acyl-CoA Retinol O-Fatty-Acyltransferase; Diglyceride Acyltransferase; EC 2.3.1.20; ARAT; DGAT; Acyl Coenzyme A:Cholesterol Acyltransferase Related Gene 1; Diacylglycerol O-Acyltransferase (Mouse) Homolog; Diacylglycerol O-Acyltransferase Homolog; Acyl-CoA:Diacylglycerol Acyltransferase |
UniProt ID | Q9SLD2 |
Protein Refseq | The length of the protein is 520 amino acids long. The sequence is show below: MAILDSAGVTTVTENGGGEFVDLDRLRRRKSRSDSSNGLLLSGSDNNSPSDDVGAPADVRDRIDSVVNDDAQGTANLAGDNNGGGDNNGGGRGGGEGRGNADATFTYRPSVPAHRRARESPLSSDAIFKQSHAGLFNLCVVVLIAVNSRLIIENLMKYGWLIRTDFWFSSRSLRDWPLFMCCISLSIFPLAAFTVEKLVLQKYISEPVVIFLHIIITMTEVLYPVYVTLRCDSAFLSGVTLMLLTCIVWLKLVSYAHTSYDIRSLANAADKANPEVSYYVSLKSLAYFMVAPTLCYQPSYPRSACIRKGWVARQFAKLVIFTGFMGFIIEQYINPIVRNSKHPLKGDLLYAIERVLKLSVPNLYVWLCMFYCFFHLWLNILAELLCFGDREFYKDWWNAKSVGDYWRMWNMPVHKWMVRHIYFPCLRSKIPKTLAIIIAFLVSAVFHELCIAVPCRLFKLWAFLGIMFQVPLVFITNYLQERFGSTVGNMIFWFIFCIFGQPMCVLLYYHDLMNRKGSMS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry