Mouse Anti-DHODH Antibody (CBMOAB-40728FYA)
Cat: CBMOAB-40728FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-40728FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) | WB, ELISA | MO40728FYA | 100 µg | ||
| CBMOAB-73444FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO73444FYA | 100 µg | ||
| MO-AB-02972H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO02972C | 100 µg | ||
| MO-AB-07900Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07900Y | 100 µg | ||
| MO-AB-08144W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08144W | 100 µg | ||
| MO-AB-11415R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO11415R | 100 µg | ||
| MO-AB-14441W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO14441W | 100 µg | ||
| MO-AB-30152W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO30152W | 100 µg | ||
| MO-AB-41567W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41567W | 100 µg | ||
| MO-AB-44423W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44423W | 100 µg | ||
| MO-AB-54171W | Monoclonal | Marmoset | WB, ELISA | MO54171W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) |
| Clone | MO40728FYA |
| Specificity | This antibody binds to Rhesus DHODH. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus DHODH Antibody is a mouse antibody against DHODH. It can be used for DHODH detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Dihydroorotate dehydrogenase (Quinone), mitochondrial; DHODH |
| UniProt ID | I0FPN7 |
| Protein Refseq | The length of the protein is 395 amino acids long. The sequence is show below: MAWRHLKKRARDAVVILGGGGLLFASYLMATGDERFYAEHLMPALQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQARLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLQGAHRPAVLVKIAPDLTAQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGRVKRELEALLKEQGFGRVTDAIGADHRR. |
For Research Use Only | Not For Clinical Use.
Online Inquiry