Mouse Anti-DLST Antibody (CBMOAB-40853FYA)


Cat: CBMOAB-40853FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40853FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO40853FYA 100 µg
CBMOAB-73680FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO73680FYA 100 µg
MO-AB-03005H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03005C 100 µg
MO-AB-11486R Monoclonal Cattle (Bos taurus) WB, ELISA MO11486R 100 µg
MO-AB-20324W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20324W 100 µg
MO-AB-54289W Monoclonal Marmoset WB, ELISA MO54289W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio)
CloneMO40853FYA
SpecificityThis antibody binds to Rhesus DLST.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Mitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a mitochondrial protein that belongs to the 2-oxoacid dehydrogenase family. This protein is one of the three components (the E2 component) of the 2-oxoglutarate dehydrogenase complex that catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). Alternatively spliced transcript variants have been found for this gene.
Product OverviewMouse Anti-Rhesus DLST Antibody is a mouse antibody against DLST. It can be used for DLST detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDLST
UniProt IDF6YI09
Protein RefseqThe length of the protein is 306 amino acids long.
The sequence is show below: RMTWLQSKPQHLQNLSQREMSGGRKVPSPANGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPAAAAPKAEPTAVPVPPPAAPIPTQMPPVPSPSQPSSSKPVSAVKPTAAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNYADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILG.
For Research Use Only | Not For Clinical Use.
Online Inquiry