Mouse Anti-Dog abca5 Antibody (MO-AB-28775W)
Cat: MO-AB-28775W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Dog (Canis lupus familiaris) |
Clone | MO28775W |
Specificity | This antibody binds to Dog abca5. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This encoded protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This gene is clustered among 4 other ABC1 family members on 17q24, but neither the substrate nor the function of this gene is known. Alternative splicing of this gene results in several transcript variants; however, not all variants have been fully described. |
Product Overview | Mouse Anti-Dog abca5 Antibody is a mouse antibody against abca5. It can be used for abca5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | ATP-binding cassette sub-family A member 5; abca5 |
UniProt ID | E0WCW5 |
Protein Refseq | The length of the protein is 46 amino acids long. The sequence is show below: ILLLDEPTAGMDPCSRHIVWNLLKYGKSNRVTVFSTHFMDEADILA. |
See other products for " ABCA5 "
CBMOAB-1256FYC | Mouse Anti-Arabidopsis ABCA5 Antibody (CBMOAB-1256FYC) |
MO-AB-24832W | Mouse Anti-Chimpanzee ABCA5 Antibody (MO-AB-24832W) |
CBMOAB-34788FYA | Mouse Anti-Rhesus ABCA5 Antibody (CBMOAB-34788FYA) |
CBMOAB-64341FYA | Mouse Anti-Zebrafish abca5 Antibody (CBMOAB-64341FYA) |
MO-AB-50183W | Mouse Anti-Marmoset ABCA5 Antibody (MO-AB-50183W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry