Mouse Anti-Dog ACY1 Antibody (MO-AB-28810W)


Cat: MO-AB-28810W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityDog (Canis lupus familiaris)
CloneMO28810W
SpecificityThis antibody binds to Dog ACY1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a cytosolic, homodimeric, zinc-binding enzyme that catalyzes the hydrolysis of acylated L-amino acids to L-amino acids and an acyl group, and has been postulated to function in the catabolism and salvage of acylated amino acids. This gene is located on chromosome 3p21.1, a region reduced to homozygosity in small-cell lung cancer (SCLC), and its expression has been reported to be reduced or undetectable in SCLC cell lines and tumors. The amino acid sequence of human aminoacylase-1 is highly homologous to the porcine counterpart, and this enzyme is the first member of a new family of zinc-binding enzymes. Mutations in this gene cause aminoacylase-1 deficiency, a metabolic disorder characterized by central nervous system defects and increased urinary excretion of N-acetylated amino acids. Alternative splicing of this gene results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream ABHD14A (abhydrolase domain containing 14A) gene, as represented in GeneID:100526760. A related pseudogene has been identified on chromosome 18.
Product OverviewMouse Anti-Dog ACY1 Antibody is a mouse antibody against ACY1. It can be used for ACY1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAminoacylase-1; EC 3.5.1.14; N-acyl-L-amino-acid amidohydrolase; ACY1
UniProt IDF1PHI4
Protein RefseqThe length of the protein is 408 amino acids long.
The sequence is show below: MASEGLEGEHPSVTLFRRYLRIRTVQPEPDYGAAVAFLEERAHQLGLGCQKVEVAPGYVVTILTWPGTNPRLSSLILNSHTDVVPVFKEHWSHDPFEAFKDAEGYIYARGAQDMKCVSIQYLEAVRRLKAEGRHFPRTIHMTFVPDEEVGGHKGMELFVQRPEFRALKAGFALDEGLANPTDAFTVFYSERSPWWVRITSTGNPGHGSRFIEDTAAEKLHKVVSSILTFREKERQRLQSNPHLKAGAVTSVNLTKLEGGVAYNVVPATMSASFDFRVAPDVELKAFEEQLQGWCQAAGDGVTFDFAQKWTESRVTSTDDSDPWWAAFSGACKDMNLTLEPEIFPAATDSRYLRAVGVPALGFSPMNLTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDG.
For Research Use Only | Not For Clinical Use.
Online Inquiry