Mouse Anti-Dog ALAD Antibody (MO-AB-28909W)


Cat: MO-AB-28909W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityDog (Canis lupus familiaris)
CloneMO28909W
SpecificityThis antibody binds to Dog ALAD.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway; zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.
Product OverviewMouse Anti-Dog ALAD Antibody is a mouse antibody against ALAD. It can be used for ALAD detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDelta-aminolevulinic acid dehydratase; EC 4.2.1.24; ALAD
UniProt IDF1PZA0
Protein RefseqThe length of the protein is 337 amino acids long.
The sequence is show below: AVIPLPTMQPQSVLHSGYFHPLLRTWQTAATTLSASNLIYPIFVTDVPDDVQPISSLPGVARYGVNRLEEMLKPLVEEGLRCVLVFGVPSRVPKDERGSAADSEDSPAIEAIRLLRKTFPSLLVACDVCLCPYTSHGHCGLLSKNGAFLAEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKEALMAHGLGNRVSVMSYSAKFASCFYGPFRDAAQSSPAFGDRRCYQLPPGARGLALRAVARDVREGADMLMVKPGMPYLDVVREVKDKHPELPLAVYHVSGEFAMLWHGARAGAFDLKAAVLEAMTAFRRAGADIIITYYTPQLLQWLKEE.
For Research Use Only | Not For Clinical Use.
Online Inquiry