Mouse Anti-Dog CD4 Antibody (MO-AB-29467W)


Cat: MO-AB-29467W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityDog (Canis lupus familiaris)
CloneMO29467W
SpecificityThis antibody binds to Dog CD4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD4 (CD4 Molecule) is a Protein Coding gene. Diseases associated with CD4 include Okt4 Epitope Deficiency and Pilonidal Sinus. Among its related pathways are G-protein signaling N-RAS regulation pathway and PEDF Induced Signaling. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and enzyme binding.
Product OverviewMouse Anti-Dog CD4 Antibody is a mouse antibody against CD4. It can be used for CD4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesT-cell surface glycoprotein CD4; T-cell surface antigen T4 / Leu-3; CD antigen CD4; CD4
UniProt IDP33705
Protein RefseqThe length of the protein is 463 amino acids long.
The sequence is show below: MNQEAAFRHLLLMLQLVMLPAVTPVREVVLGKAGDAVELPCQTSQKKNIHFNWRDSSMVQILGNQGSFWTVGSSRLKHRVESKKNLWDQGSFPLVIKDLEVADSGIYFCDTDKRQEVELLVFNLTAKWDSGSSSGSSNIRLLQGQQLTLTLENPSGSSPSVQWKGPGNKSKHGGQNLSLSWPELQDGGTWTCIISQSQKTVEFNINVLVLAFQKVSNTFYAREGDQVEFSFPLSFEDENLVGELRWQAQGASSSLLWISFTLENRKLSMKEAHAPLKLQMKESLPLRFTLPQVLSRYAGSGILTLNLAKGTLYQEVNLVVMRANSSQNNLTCEVLGPTSPELTLSLNLKEQAAKVSKQQKLVWVVDPEGGTWQCLLSDKDKVLLASSLNVSSPVVIKSWPKFLAITLGGILGLLLLIGLCVFCCVKCWRRRRQAERMSQIKRLLSEKKTCQCSHRIQKTCSLI.

Reference

ReferenceSgrignoli, M. R., Silva, D. A., Nascimento, F. F., Sgrignoli, D. A. M., Nai, G. A., da Silva, M. G., ... & Andrade, S. F. (2019). Reduction in the inflammatory markers CD4, IL-1, IL-6 and TNFα in dogs with keratoconjunctivitis sicca treated topically with mesenchymal stem cells. Stem Cell Research, 39, 101525.
See other products for " CD4 "
CBMOAB-00058FYAMouse Anti-Cattle CD4 Antibody (CBMOAB-00058FYA)
CBMOAB-00057FYAMouse Anti-Cattle CD4 Antibody (CBMOAB-00057FYA)
MOFY-0722-FY106Biotin conjugated antibody to CD4 Antibody (MOFY-0722-FY106)
MOFY-0722-FY429Rabbit Anti-CD4 Antibody (MOFY-0722-FY429)
CBMOAB-00163FYAMouse Anti-Hamster CD4 Antibody (CBMOAB-00163FYA)
CBMOAB-69695FYAMouse Anti-Zebrafish cd4 Antibody (CBMOAB-69695FYA)
MOFY-0522-FY52Mouse Anti-CD4 Antibody (MOFY-0522-FY52)
MO-AB-14502YMouse Anti-Sheep CD4 Antibody (MO-AB-14502Y)
MOFY-0522-FY27Mouse Anti-CD4 Antibody (MOFY-0522-FY27)
MO-AB-00183RMouse Anti-Medaka CD4 Antibody (MO-AB-00183R)
For Research Use Only | Not For Clinical Use.
Online Inquiry