Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September, the 10th Annual Immuno-Oncology Summit in October, and the Antibody Engineering & Therapeutics (US) 2022 in December for expert consultation on your drug discovery projects. Shoot an email to arrange an in-person meeting!

Mouse Anti-Dog CR2 Antibody (MO-AB-29896W)


Cat: MO-AB-29896W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityDog (Canis lupus familiaris)
CloneMO29896W
SpecificityThis antibody binds to Dog CR2.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCR2 (Complement C3d Receptor 2) is a Protein Coding gene. Diseases associated with CR2 include Immunodeficiency, Common Variable, 7 and Systemic Lupus Erythematosus 9. Among its related pathways are Complement and coagulation cascades and 4-1BB Pathway. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and transmembrane signaling receptor activity. An important paralog of this gene is CR1.
Product OverviewMouse Anti-Dog CR2 (clone MO29896W) Antibody (MO-AB-29896W) is a mouse antibody against CR2. It can be used for CR2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesComplement receptor type 2; CR2
UniProt IDQ5NT87
Protein RefseqThe length of the protein is 136 amino acids long.
The sequence is show below: FSPGMSILYNCDQGYLLVGVALLLCTHDGTWSQPAPYCKEVNCSSPEYINGIQKGLEPGKMYQYGAVVTLECEEGYTLEGSPQSQCQDDHGWNPPLAVCKSPASLAPLLSGLSAGSVLLIFLIGVTLCMILKHRER.
For Research Use Only | Not For Clinical Use.

Online Inquiry