Mouse Anti-Dog CR2 Antibody (MO-AB-29896W)


Cat: MO-AB-29896W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityDog (Canis lupus familiaris)
CloneMO29896W
SpecificityThis antibody binds to Dog CR2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCR2 (Complement C3d Receptor 2) is a Protein Coding gene. Diseases associated with CR2 include Immunodeficiency, Common Variable, 7 and Systemic Lupus Erythematosus 9. Among its related pathways are Complement and coagulation cascades and 4-1BB Pathway. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and transmembrane signaling receptor activity. An important paralog of this gene is CR1.
Product OverviewMouse Anti-Dog CR2 Antibody is a mouse antibody against CR2. It can be used for CR2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesComplement receptor type 2; CR2
UniProt IDQ5NT87
Protein RefseqThe length of the protein is 136 amino acids long.
The sequence is show below: FSPGMSILYNCDQGYLLVGVALLLCTHDGTWSQPAPYCKEVNCSSPEYINGIQKGLEPGKMYQYGAVVTLECEEGYTLEGSPQSQCQDDHGWNPPLAVCKSPASLAPLLSGLSAGSVLLIFLIGVTLCMILKHRER.
For Research Use Only | Not For Clinical Use.
Online Inquiry