Mouse Anti-Dog DES Antibody (MO-AB-30136W)


Cat: MO-AB-30136W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityDog (Canis lupus familiaris)
CloneMO30136W
SpecificityThis antibody binds to Dog DES.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Cytoskeleton; Nucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a muscle-specific class III intermediate filament. Homopolymers of this protein form a stable intracytoplasmic filamentous network connecting myofibrils to each other and to the plasma membrane. Mutations in this gene are associated with desmin-related myopathy, a familial cardiac and skeletal myopathy (CSM), and with distal myopathies.
Product OverviewMouse Anti-Dog DES Antibody is a mouse antibody against DES. It can be used for DES detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDesmin; DES
UniProt IDQ5XFN2
Protein RefseqThe length of the protein is 469 amino acids long.
The sequence is show below: MSQAYSSSQRVSSYRRTFGGAGGFPLGSPLGSPVFPRAGFGTKGSSSSVTSRVYQVSRTSGGAGGLGALRAGRLGTGRAPSYSAGELLDFSLADAVNQEFLTTRTNEKVELQELNDRFANYIEKVRFLEQQNAALAAEVNRLKGREPTRVAEIYEEELRELRRQVEVLTNQRARVDVERDNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMREMEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL.
See other products for " DES "
MO-AB-01578YMouse Anti-Chicken DES Antibody (MO-AB-01578Y)
CBMOAB-00273FYARabbit Anti-Mouse DES Antibody (CBMOAB-00273FYA)
MO-NAB-00381WRabbit Anti-DES Antibody (C-terminal)
MO-AB-54117WMouse Anti-Marmoset DES Antibody (MO-AB-54117W)
MOFY-0522-FY132Mouse Anti-DES Antibody (MOFY-0522-FY132)
MOFY-0522-FY91Mouse Anti-DES Antibody (MOFY-0522-FY91)
MO-AB-02956HMouse Anti-Frog des Antibody (MO-AB-02956H)
MO-DKB-00352WRabbit Anti-DES Antibody (MO-DKB-00352W)
MO-AB-07887YMouse Anti-Rabbit DES Antibody (MO-AB-07887Y)
MOFY-0522-FY121Mouse Anti-DES Antibody (MOFY-0522-FY121)
For Research Use Only | Not For Clinical Use.
Online Inquiry