Mouse Anti-Dog GAL Antibody (MO-AB-30871W)


Cat: MO-AB-30871W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityDog (Canis lupus familiaris)
CloneMO30871W
SpecificityThis antibody binds to Dog GAL.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a neuroendocrine peptide that is widely expressed in the central and peripheral nervous systems and also the gastrointestinal tract, pancreas, adrenal gland and urogenital tract. The encoded protein is a precursor that is proteolytically processed to generate two mature peptides: galanin and galanin message-associated peptide (GMAP). Galanin has diverse physiological functions including nociception, feeding and energy homeostasis, osmotic regulation and water balance. GMAP has been demonstrated to possess antifungal activity and hypothesized to be part of the innate immune system.
Product OverviewMouse Anti-Dog GAL (clone MO30871W) Antibody (MO-AB-30871W) is a mouse antibody against GAL. It can be used for GAL detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGalanin peptides; GAL
UniProt IDF1PM29
Protein RefseqThe length of the protein is 125 amino acids long.
The sequence is show below: MPGGCALLLAWLLLAAALSATPGLGAPVKEKRGWTLNSAGYLLGPHAIDNHRSFHEKPGLTGKRELPPEDEGRSGGFAGPLSLSENAAVRMLIEFLTFLRLKEAGALPDLPDLPSAVSAEDMEQP.
For Research Use Only | Not For Clinical Use.

Online Inquiry