Mouse Anti-Dog IL2RA Antibody (MO-AB-31286W)


Cat: MO-AB-31286W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityDog (Canis lupus familiaris)
CloneMO31286W
SpecificityThis antibody binds to Dog IL2RA.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe interleukin 2 (IL2) receptor alpha (IL2RA) and beta (IL2RB) chains, together with the common gamma chain (IL2RG), constitute the high-affinity IL2 receptor. Homodimeric alpha chains (IL2RA) result in low-affinity receptor, while homodimeric beta (IL2RB) chains produce a medium-affinity receptor. Normally an integral-membrane protein, soluble IL2RA has been isolated and determined to result from extracellular proteolyisis. Alternately-spliced IL2RA mRNAs have been isolated, but the significance of each is presently unknown. Mutations in this gene are associated with interleukin 2 receptor alpha deficiency.
Product OverviewMouse Anti-Dog IL2RA Antibody is a mouse antibody against IL2RA. It can be used for IL2RA detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInterleukin-2 receptor subunit alpha; IL2RA
UniProt IDF1PB00
Protein RefseqThe length of the protein is 272 amino acids long.
The sequence is show below: LEAGLIIIWSSSLFPYLLSMRHIPDLCDDDPPNLKHATFKALTYKTGTVLNCDCERGFRRISSYMHCTGNSSHASWENKCQCKSISPENRKGKVTTKPEEQKGENPTEMQSQTPPMDEVDLVGHCREPPPWEHENSKRIYHFVVGQTLHYQCMQGFTALHRGPAKSICKTIFGKTRWTQPPLKCISESQFPDDEELQASTDAPAGRDTSSPFITTSTPDFHKHTEVATTMESFIFTTEYQIAVASCVLLLISIVLLSGLTWQRRRRGSWAEI.
For Research Use Only | Not For Clinical Use.
Online Inquiry