Mouse Anti-EFNB1 Antibody (MO-AB-54736W)


Cat: MO-AB-54736W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-54736W Monoclonal Marmoset, Cattle (Bos taurus), Human (Homo sapiens), Rat (Rattus norvegicus), Mouse (Mus musculus), Dog (Canis lupus familiaris), Chicken (Gallus gallus), Primate, Zebrafish (Danio rerio), Frog (Xenopus) WB, ELISA MO54736W 100 µg
CBMOAB-74558FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO74558FYA 100 µg
MO-AB-11867R Monoclonal Cattle (Bos taurus) WB, ELISA MO11867R 100 µg
MO-DKB-03252W Polyclonal Human (Homo sapiens), Rat (Rattus norvegicus), Human (Homo sapiens), Mouse (Mus musculus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Chicken (Gallus gallus), Primate, Zebrafish (Danio rerio) WB 100 µg
MO-DKB-03383W Polyclonal Mouse (Mus musculus), Rat (Rattus norvegicus), Chicken (Gallus gallus), Human (Homo sapiens), Cattle (Bos taurus), Chicken (Gallus gallus), Frog (Xenopus), Zebrafish (Danio rerio) WB, IF 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset, Cattle (Bos taurus), Human (Homo sapiens), Rat (Rattus norvegicus), Mouse (Mus musculus), Dog (Canis lupus familiaris), Chicken (Gallus gallus), Primate, Zebrafish (Danio rerio), Frog (Xenopus)
CloneMO54736W
SpecificityThis antibody binds to Marmoset EFNB1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a type I membrane protein and a ligand of Eph-related receptor tyrosine kinases. It may play a role in cell adhesion and function in the development or maintenance of the nervous system.
Product OverviewMouse Anti-Marmoset EFNB1 Antibody is a mouse antibody against EFNB1. It can be used for EFNB1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEphrin-B1; EFNB1
UniProt IDF7IDP5
Protein RefseqThe length of the protein is 346 amino acids long.
The sequence is show below: MARPGQRWLGKWLVAMVVWALCRLATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKTATQAPGGRGSLGDSDGKHETVNQEEKSGPGASGGGSGDPDGFFNSKVALFAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALSLSTLASPKGGSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV.
For Research Use Only | Not For Clinical Use.
Online Inquiry