Mouse Anti-EMILIN1 Antibody (CBMOAB-41722FYA)


Cat: CBMOAB-41722FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41722FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, O. mykiss (Oncorhynchus mykiss) WB, ELISA MO41722FYA 100 µg
MO-AB-11325Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO11325Y 100 µg
MO-AB-13079W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13079W 100 µg
MO-AB-54921W Monoclonal Marmoset WB, ELISA MO54921W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, O. mykiss (Oncorhynchus mykiss)
CloneMO41722FYA
SpecificityThis antibody binds to Rhesus EMILIN1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an extracellular matrix glycoprotein that is characterized by an N-terminal microfibril interface domain, a coiled-coiled alpha-helical domain, a collagenous domain and a C-terminal globular C1q domain. The encoded protein associates with elastic fibers at the interface between elastin and microfibrils and may play a role in the development of elastic tissues including large blood vessels, dermis, heart and lung.
Product OverviewMouse Anti-Rhesus EMILIN1 Antibody is a mouse antibody against EMILIN1. It can be used for EMILIN1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEMILIN-1; EMILIN1
UniProt IDH9FJ66
Protein RefseqThe length of the protein is 218 amino acids long.
The sequence is show below: EKLVGGQAGLGRRLGALNSSLQLLEDRLHQLSLKDLTGPAGEAGPPGPPGLQGPPGPAGPPGSPGKDGQEGPIGPPGPQGEQGVEGAPAAPVPRVAFSAALSLPRSEPGTVPFDRVLLNDGGYYDPETGVFTAPLAGRYLLSAVLTGHRHEKVEAVLSRSNQGVARVDSGGYEPEGLENKPVAESQPSPGTLGVFSLILPLQAGDTVCVVLVMGQLAH.
For Research Use Only | Not For Clinical Use.
Online Inquiry