Mouse Anti-ENPEP Antibody (CBMOAB-41790FYA)


Cat: CBMOAB-41790FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41790FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Pig (Sus scrofa), Zebrafish (Danio rerio) WB, ELISA MO41790FYA 100 µg
CBMOAB-75040FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO75040FYA 100 µg
MO-AB-12034R Monoclonal Cattle (Bos taurus) WB, ELISA MO12034R 100 µg
MO-AB-25596R Monoclonal Pig (Sus scrofa) WB, ELISA MO25596R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Pig (Sus scrofa), Zebrafish (Danio rerio)
CloneMO41790FYA
SpecificityThis antibody binds to Rhesus ENPEP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionENPEP (Glutamyl Aminopeptidase) is a Protein Coding gene. Diseases associated with ENPEP include Neurogenic Hypertension and Gestational Choriocarcinoma. Among its related pathways are Peptide hormone metabolism and Agents Acting on the Renin-Angiotensin System Pathway, Pharmacodynamics. Gene Ontology (GO) annotations related to this gene include peptidase activity and aminopeptidase activity. An important paralog of this gene is ANPEP.
Product OverviewMouse Anti-Rhesus ENPEP Antibody is a mouse antibody against ENPEP. It can be used for ENPEP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlutamyl aminopeptidase; ENPEP
UniProt IDH9F6K3
Protein RefseqThe length of the protein is 98 amino acids long.
The sequence is show below: NSYGKNMAWNWIQLNWDYLVNRFTLNNRNLGRIVTIAEPFNTELQLWQMESFFAKYPQAGAGEKPREQVLETVKNNIEWLKQHRNTIREWFLNLLESG.
See other products for " ENPEP "
For Research Use Only | Not For Clinical Use.
Online Inquiry