Mouse Anti-ETNK1 Antibody (CBMOAB-42026FYA)


Cat: CBMOAB-42026FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42026FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio) WB, ELISA MO42026FYA 100 µg
CBMOAB-59851FYC Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59851FYC 100 µg
CBMOAB-75415FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO75415FYA 100 µg
MO-AB-19695W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19695W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio)
CloneMO42026FYA
SpecificityThis antibody binds to Rhesus ETNK1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an ethanolamine kinase, which functions in the first committed step of the phosphatidylethanolamine synthesis pathway. This cytosolic enzyme is specific for ethanolamine and exhibits negligible kinase activity on choline. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Product OverviewMouse Anti-Rhesus ETNK1 Antibody is a mouse antibody against ETNK1. It can be used for ETNK1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesETNK1
UniProt IDF7A0J7
Protein RefseqThe length of the protein is 293 amino acids long.
The sequence is show below: QLFTDGITNKLIGCYVGNTMEDVVLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCYEFIQGEALDPKHVCNPAIFRLIARQLAKIHAIHAHNGWIPKSNLWLKMGKYFSLIPTGFADEDINKRFLSDIPSSQILQEEMTWMKEILSNLGSPVVLCHNDLLCKNIIYNEKQGRMQAIDNTYLNEVYVLKFFSVFFFSSKGVSDVDYSLYPDRELQSQWLRAYLEAYKEFKGFGTEVTEKEVEILFIQVNQFALGENLNFIIGNKYCQLFSLKLLISFGDCGL.
For Research Use Only | Not For Clinical Use.
Online Inquiry